WORLD PEPTIDEFOUNDATION

Where is Teriparatide being studied?

Find registered human studies, phases, products, recruitment status and reported research locations around the world. Registry search matches are separate from this profile’s reviewed evidence.

Find studies for Teriparatide →Worldwide registry directory

Scientific intelligence record

Experience 2.0

Recombinant human parathyroid hormone fragment (PTH 1-34)

Teriparatide

Teriparatide is the recombinant 1–34 amino-acid fragment of human parathyroid hormone and retains the receptor-active N-terminal region of PTH. Intermittent subcutaneous exposure activates PTH1 receptors in bone and kidney; in bone it increases osteoblast activity and remodeling, producing an anabolic treatment effect when used according to an approved regimen. Its effects depend on exposure pattern: intermittent therapeutic administration is not equivalent to sustained endogenous parathyroid-hormone excess. Evidence and authorization are formulation-, indication-, population-, duration-, and sequence-specific.

Record status

Traceability partial

Last meaningful update: 9/20/2026

Evidence searched through:
Not recorded
Assessment updated:
9/20/2026
Documented human review:
No documented human review recorded
Automated scientific assessment:
None recorded
AI source check:
9/26/2026

Published source links and profile text pass separate gates. Only a documented human review is labelled as human review; an automated scientific assessment applies deterministic checks, and an AI source check confirms only that a source exists and matches its identifiers. A source count alone does not establish a review.

Evidence coverage has three distinct layers. The corpus count is a transparent screening inventory, the featured set contains study-level tiering and interpretation, and the published-source count contains records promoted through the institutional publication workflow. Source validation, editorial publication, and scientific appraisal are separate decisions; these numbers must not be merged.

Ranked research corpus

500

Categorized publications with provisional ranking; scientific review remains separate.

Featured tiered studies

0

Cornerstone publications with study-level interpretation, limitations, and tier disclosure.

Research domains

5

Clinical and scientific questions synthesized independently across the evidence atlas.

Published source records

25

Database records promoted through the governed publication workflow—not the corpus total.

Corpus generated 2026-09-18. Counts remain separately labeled so screening is not represented as completed review.

Human experience · separate evidence stream

No community pattern is displayed yet

Eligible observations remain below the privacy and reliability threshold. WPF will not convert a handful of reports into a percentage, trend, or clinical claim.

Observation is valuable human context. It is not evidence of causation, efficacy, or safety.

Public display gate

n ≥ 20 eligible observations

Exact progress remains private before the threshold.

Contribute an observationArchive details

Intelligence snapshot

The state of the record

A compact view of what is represented, what remains unresolved, and how completely the record can be traced.

Ranked research corpus

500

Categorized screening records; proposed rankings remain pending human appraisal.

Featured tiered studies

0

Cornerstone studies with published study-level interpretation and tier disclosure.

Research domains

5

Independent evidence dossiers covering the major research questions.

Published source records

25

Source records published through the governed workflow; this count does not certify scientific conclusions.

Contradictions

0

Conflicting evidence relationships that remain visible.

Research gaps

1

Questions the current record identifies as unresolved.

Connected media

0

Media records explicitly linked to this scientific record.

What we know

Evidence, claims, and boundaries

The project separates represented evidence from qualification, contradiction, uncertainty, and what the evidence does not establish.

Reconciled domain conclusions

5 published domain syntheses connected to 0 featured studies

Teriparatide no longer relies on the legacy “no public claim” state. Each research domain publishes a bounded synthesis, confidence level, evidence context, limitations, geographic applicability, regulatory interpretation, and research gaps. Publication of these syntheses is separate from the scientific review status shown above.

Inspect the reconciled evidence atlas
Inspect the published evidence record25 governed records · titles, provenance, and original-source linksOpen records ↓
2015Phase 3 human evidence
Evidence strength A · 91/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Efficacy of weekly teriparatide does not vary by baseline fracture probability calculated using FRAX.

The aim of this study was to determine the efficacy of once-weekly teriparatide as a function of baseline fracture risk.

Authors
N C Harvey, J A Kanis, A Odén, T Nakamura, M Shiraki, T Sugimoto, T Kuroda, H Johansson, E V McCloskey
Source
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
DOI
10.1007/s00198-015-3129-7
PubMed
26092062
Open original source
2023Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Biosimilarity Assessment of the Biosimilar Teriparatide Candidate and the Reference Drug in Healthy Subjects.

SAL001, a recombinant form of parathyroid hormone, is a biosimilar drug to teriparatide and is planned to be used in osteoporosis treatment.

Authors
Xuan Wang, Xintong Liang, Tenghua Wang, Yaoxuan Zhan, Haiyan Liu, Chen Li, Xianbo Li, Hui Ma, Zhiqin Hu, Xiaole Wang, Shuangshuang Xiao, Li Ban
Source
Clinical pharmacology in drug development
DOI
10.1002/cpdd.1221
PubMed
36710466
Open original source
2020Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Standard Versus Cyclic Teriparatide and Denosumab Treatment for Osteoporosis: A Randomized Trial.

In the absence of an intervening antiresorptive agent, cyclic administration of teriparatide does not increase bone mineral density (BMD) more than standard daily therapy.

Authors
Felicia Cosman, Donald McMahon, David Dempster, Jeri W Nieves
Source
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research
DOI
10.1002/jbmr.3850
PubMed
31419313
Open original source
2007Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide or alendronate in glucocorticoid-induced osteoporosis.

Bisphosphonate therapy is the current standard of care for the prevention and treatment of glucocorticoid-induced osteoporosis.

Authors
Kenneth G Saag, Elizabeth Shane, Steven Boonen, Fernando Marín, David W Donley, Kathleen A Taylor, Gail P Dalsky, Robert Marcus
Source
The New England journal of medicine
DOI
10.1056/nejmoa071408
PubMed
18003959
Open original source
2023Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Sequential therapy with once-weekly teriparatide injection followed by alendronate versus monotherapy with alendronate alone in patients at high risk of osteoporotic fracture: final results of the Japanese Osteoporosis Intervention Trial-05.

In this randomized, controlled trial, sequential therapy with once-weekly subcutaneous injection of teriparatide for 72 weeks, followed by alendronate for 48 weeks resulted in a significantly lower incidence of morphometric vertebral fracture than monotherapy with alendronate for 120 weeks in women with osteoporosis at high risk of fracture.

Authors
Satoshi Mori, Hiroshi Hagino, Toshitsugu Sugimoto, Shiro Tanaka, Yuji Mitomo, Kaito Takahashi, Teruki Sone, Toshitaka Nakamura, Satoshi Soen
Source
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
DOI
10.1007/s00198-022-06570-0
PubMed
36239756
Open original source
2015Phase 1–2 human evidence

Denosumab and teriparatide transitions in postmenopausal osteoporosis (the DATA-Switch study): extension of a randomised controlled trial.

Unlike most chronic diseases, osteoporosis treatments are generally limited to a single drug at a fixed dose and frequency.

Authors
Benjamin Z Leder, Joy N Tsai, Alexander V Uihlein, Paul M Wallace, Hang Lee, Robert M Neer, Sherri-Ann M Burnett-Bowie
Source
Lancet (London, England)
DOI
10.1016/s0140-6736(15)61120-5
PubMed
26144908
Open original source
2018Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Effects of teriparatide and risedronate on new fractures in post-menopausal women with severe osteoporosis (VERO): a multicentre, double-blind, double-dummy, randomised controlled trial.

No clinical trials have compared osteoporosis drugs with incident fractures as the primary outcome.

Authors
David L Kendler, Fernando Marin, Cristiano A F Zerbini, Luis A Russo, Susan L Greenspan, Vit Zikan, Alicia Bagur, Jorge Malouf-Sierra, Péter Lakatos, Astrid Fahrleitner-Pammer, Eric Lespessailles, Salvatore Minisola
Source
Lancet (London, England)
DOI
10.1016/s0140-6736(17)32137-2
PubMed
29129436
Open original source
2020Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide Promotes Bone Healing in Medication-Related Osteonecrosis of the Jaw: A Placebo-Controlled, Randomized Trial.

Medication-related osteonecrosis of the jaw (MRONJ) is an infrequent but morbid and potentially serious condition associated with antiresorptive and antiangiogenic therapies.

Authors
Ie-Wen Sim, Gelsomina L Borromeo, Claudine Tsao, Rita Hardiman, Michael S Hofman, Christian Papatziamos Hjelle, Musib Siddique, Gary J R Cook, John F Seymour, Peter R Ebeling
Source
Journal of clinical oncology : official journal of the American Society of Clinical Oncology
DOI
10.1200/jco.19.02192
PubMed
32614699
Open original source
2022Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide and pelvic fracture healing: a phase 2 randomized controlled trial.

Pelvic fracture patients were randomized to blinded daily subcutaneous teriparatide (TPTD) or placebo to assess healing and functional outcomes over 3 months.

Authors
J W Nieves, F Cosman, D McMahon, M Redko, I Hentschel, R Bartolotta, M Loftus, J J Kazam, J Rotman, J Lane
Source
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
DOI
10.1007/s00198-021-06065-4
PubMed
34383100
Open original source
2022Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide treatment in severe osteoporosis - a controlled 10-year follow-up study.

Teriparatide was the first anabolic agent recommended for the treatment of osteoporosis.

Authors
Georgios Kontogeorgos, Emily Krantz, Penelope Trimpou, Christine M Laine, Kerstin Landin-Wilhelmsen
Source
BMC musculoskeletal disorders
DOI
10.1186/s12891-022-05987-2
PubMed
36424580
Open original source
2016Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Relative bioavailability between two teriparatide formulations in healthy volunteers.

To compare the pharmacokinetics, relative bioavailability (RB), immunogenicity, and safety after a single dose of test or reference formulation of teriparatide in healthy human volunteers in order to demonstrate whether both products are similar.

Authors
Javier Farías, Guillermo A Keller, Mariana Papouchado, María C Villa Etchegoyen, Marcelo E Criscuolo, Roberto A Diez, Guillermo Di Girolamo
Source
International journal of clinical pharmacology and therapeutics
DOI
10.5414/cp202562
PubMed
27007999
Open original source
2017Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Relationship between bone turnover and density with teriparatide, denosumab or both in women in the DATA study.

While changes in biochemical markers of bone turnover (BTM) have been reported to predict changes in bone mineral density (BMD), the relationship between changes in BMD and BTMs with combined antiresorptive/anabolic therapy is unknown.

Authors
J N Tsai, S M Burnett-Bowie, H Lee, B Z Leder
Source
Bone
DOI
10.1016/j.bone.2016.11.009
PubMed
27840301
Open original source
2013Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide and denosumab, alone or combined, in women with postmenopausal osteoporosis: the DATA study randomised trial.

Osteoporosis medications increase bone-mineral density (BMD) and lower but do not eliminate fracture risk.

Authors
Joy N Tsai, Alexander V Uihlein, Hang Lee, Ruchit Kumbhani, Erica Siwila-Sackman, Elizabeth A McKay, Sherri-Ann M Burnett-Bowie, Robert M Neer, Benjamin Z Leder
Source
Lancet (London, England)
DOI
10.1016/s0140-6736(13)60856-9
PubMed
23683600
Open original source
2005Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide reduces the fracture risk associated with increasing number and severity of osteoporotic fractures.

The relationship between prior fractures and risk of new fractures was evaluated in 931 postmenopausal women with prevalent vertebral fractures randomized to daily placebo or teriparatide (20 mug) in the Fracture Prevention Trial.

Authors
J Christopher Gallagher, Harry K Genant, Gerald G Crans, Socorro Juan Vargas, John H Krege
Source
The Journal of clinical endocrinology and metabolism
DOI
10.1210/jc.2004-0826
PubMed
15613428
Open original source
2014Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Two years of Denosumab and teriparatide administration in postmenopausal women with osteoporosis (The DATA Extension Study): a randomized controlled trial.

Current osteoporosis medications increase bone mineral density (BMD) modestly and reduce, but do not eliminate, fracture risk.

Authors
Benjamin Z Leder, Joy N Tsai, Alexander V Uihlein, Sherri-Ann M Burnett-Bowie, Yuli Zhu, Katelyn Foley, Hang Lee, Robert M Neer
Source
The Journal of clinical endocrinology and metabolism
DOI
10.1210/jc.2013-4440
PubMed
24517156
Open original source
2015Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

FRAX and the effect of teriparatide on vertebral and non-vertebral fracture.

Daily teriparatide injections have been shown to reduce vertebral and non-vertebral fractures.

Authors
N C Harvey, J A Kanis, A Odén, R T Burge, B H Mitlak, H Johansson, E V McCloskey
Source
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
DOI
10.1007/s00198-015-3173-3
PubMed
26092063
Open original source
2003Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide (forteo) for osteoporsis.

PubMed-indexed source directly addressing teriparatide within its stated study design.

Source
The Medical letter on drugs and therapeutics
PubMed
12571538
Open original source
2022Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Randomized controlled trial of daily teriparatide, weekly high-dose teriparatide, or bisphosphonate in patients with postmenopausal osteoporosis: The TERABIT study.

The effects of daily teriparatide (20 μg) (D-PTH), weekly high-dose teriparatide (56.5 μg) (W-PTH), or bisphosphonates (BPs) on areal bone mineral density (aBMD), bone turnover markers (BTMs), volumetric BMD (vBMD), microarchitecture, and estimated strength were investigated in postmenopausal osteoporosis patients.

Authors
Ko Chiba, Narihiro Okazaki, Ayako Kurogi, Tsuyoshi Watanabe, Ai Mori, Nobuhiko Suzuki, Koichi Adachi, Makoto Era, Kazuaki Yokota, Takuma Inoue, Yoshihiro Yabe, Keizo Furukawa
Source
Bone
DOI
10.1016/j.bone.2022.116416
PubMed
35398293
Open original source
2012Phase 1–2 human evidence
Evidence strength B · 80/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Teriparatide and the risk of nonvertebral fractures in women with postmenopausal osteoporosis.

In the Fracture Prevention Trial, the risks of any nonvertebral fracture (relative risk [RR] 0.65, P=0.04) and any fragility nonvertebral fracture (RR 0.47, P=0.02) were significantly reduced in the teriparatide 20 μg/day (teriparatide) versus placebo group.

Authors
J H Krege, X Wan
Source
Bone
DOI
10.1016/j.bone.2011.10.018
PubMed
22036910
Open original source
2019Observational human evidence
Evidence strength B · 75/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Comparison of Teriparatide and Denosumab in Patients Switching From Long-Term Bisphosphonate Use.

Teriparatide and denosumab are effective treatments for osteoporosis and typically reserved as second-line options after patients have used bisphosphonates.

Authors
Houchen Lyu, Sizheng S Zhao, Kazuki Yoshida, Sara K Tedeschi, Chang Xu, Sagar U Nigwekar, Benjamin Z Leder, Daniel H Solomon
Source
The Journal of clinical endocrinology and metabolism
DOI
10.1210/jc.2019-00924
PubMed
31265071
Open original source
2023Observational human evidence

Effectiveness and Safety of Treatments to Prevent Fractures in People With Low Bone Mass or Primary Osteoporosis: A Living Systematic Review and Network Meta-analysis for the American College of Physicians.

The prevalence of osteoporosis is increasing in the United States.

Authors
Chelsea Ayers, Devan Kansagara, Brittany Lazur, Rongwei Fu, Amy Kwon, Curtis Harrod
Source
Annals of internal medicine
DOI
10.7326/m22-0684
PubMed
36592455
Open original source
2024Observational human evidence
Evidence strength A · 88/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Efficacy and safety of teriparatide vs. bisphosphonates and denosumab vs. bisphosphonates in osteoporosis not previously treated with bisphosphonates: a systematic review and meta-analysis of randomized controlled trials.

The study found that in osteoporosis patients who had not previously received bisphosphonate treatment and were in a treatment cycle of over 12 months, both teriparatide and denosumab significantly increased bone mineral density compared to bisphosphonates.

Authors
Mingnian Li, Zhuoqi Ge, Benqi Zhang, Li Sun, Zhongyuan Wang, Tao Zou, Qi Chen
Source
Archives of osteoporosis
DOI
10.1007/s11657-024-01447-7
PubMed
39312040
Open original source
2025Observational human evidence
Evidence strength A · 88/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
70/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

PTH1 receptor agonists for fracture risk: a systematic review and network meta-analysis.

Osteoporosis, defined by reduced bone mineral density and macro- and micro-architectural degradation, leads to increased fracture risk, particularly in aging populations.

Authors
Charlotte Beaudart, Nicola Veronese, Jonathan Douxfils, Jotheeswaran Amuthavalli Thiyagarajan, Francesco Bolzetta, Paolo Albanese, Gianpaolo Voltan, Majed Alokail, Nicholas C Harvey, Nicholas R Fuggle, Olivier Bruyère, René Rizzoli
Source
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
DOI
10.1007/s00198-025-07440-1
PubMed
40047881
Open original source
2020Observational human evidence
Evidence strength A · 88/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Denosumab, raloxifene, romosozumab and teriparatide to prevent osteoporotic fragility fractures: a systematic review and economic evaluation.

Fragility fractures are fractures that result from mechanical forces that would not ordinarily result in fracture.

Authors
Sarah Davis, Emma Simpson, Jean Hamilton, Marrissa Martyn-St James, Andrew Rawdin, Ruth Wong, Edward Goka, Neil Gittoes, Peter Selby
Source
Health technology assessment (Winchester, England)
DOI
10.3310/hta24290
PubMed
32588816
Open original source
2016Observational human evidence
Evidence strength B · 75/100 · ProvisionalHow this is rated

This score estimates how strongly this source can support scientific claims. It is not a prestige score, and the grade does not transfer automatically to every claim that cites the source.

Grade guide: A+/A is the strongest represented support; B+/B is substantial but qualified; C is limited, indirect, observational, or preclinical; D/E is weak, mechanistic-only, anecdotal, or insufficient.

Directness
85/100
Replication
70/100

Provisional ratings are automated baselines from structured metadata. They are not completed full-text risk-of-bias reviews and may change after editorial assessment.

Methodology: WPF-ESR-1.0

Safety and effectiveness of daily teriparatide in a prospective observational study in patients with osteoporosis at high risk of fracture in Japan: final report.

This postmarketing surveillance study assessed the safety and effectiveness of teriparatide in patients with osteoporosis at high risk of fracture in Japan.

Authors
Atsushi Nishikawa, Takehiro Ishida, Masanori Taketsuna, Fumito Yoshiki, Hiroyuki Enomoto
Source
Clinical interventions in aging
DOI
10.2147/cia.s107285
PubMed
27462147
Open original source

Scientific context

Chemistry and represented biological context

Existing reviewed chemistry is preserved as scientific context. Chemistry and mechanism information do not establish clinical efficacy or safety.

Open chemistry and biological context ↓
Chemical identity

Molecular and structural record

Structured record
Molecular formula
C181H291N55O51S2
Molecular weight (Da)
4118
Amino acid sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
SMILES
CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CNC=N2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC5=CNC=N5)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC6=CC=CC=C6)C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CO)N
InChI
InChI=1S/C181H291N55O51S2/c1-21-96(18)146(236-160(267)114(48-53-141(250)251)212-174(281)132(84-239)232-177(284)143(93(12)13)233-147(254)103(185)82-237)178(285)216-111(45-50-134(187)241)155(262)219-119(65-90(6)7)163(270)213-116(55-62-289-20)158(265)224-124(71-100-79-196-86-203-100)167(274)226-126(73-135(188)242)169(276)217-117(63-88(2)3)148(255)201-81-138(245)205-105(39-27-30-56-182)149(256)223-123(70-99-78-195-85-202-99)166(273)221-121(67-92(10)11)164(271)225-128(75-137(190)244)171(278)231-131(83-238)173(280)214-115(54-61-288-19)157(264)210-112(46-51-139(246)247)153(260)208-109(43-34-60-199-181(193)194)159(266)234-144(94(14)15)175(282)215-113(47-52-140(248)249)156(263)222-122(69-98-77-200-104-38-26-25-37-102(98)104)165(272)220-120(66-91(8)9)161(268)209-108(42-33-59-198-180(191)192)151(258)206-106(40-28-31-57-183)150(257)207-107(41-29-32-58-184)152(259)218-118(64-89(4)5)162(269)211-110(44-49-133(186)240)154(261)228-129(76-142(252)253)172(279)235-145(95(16)17)176(283)229-125(72-101-80-197-87-204-101)168(275)227-127(74-136(189)243)170(277)230-130(179(286)287)68-97-35-23-22-24-36-97/h22-26,35-38,77-80,85-96,103,105-132,143-146,200,237-239H,21,27-34,39-76,81-84,182-185H2,1-20H3,(H2,186,240)(H2,187,241)(H2,188,242)(H2,189,243)(H2,190,244)(H,195,202)(H,196,203)(H,197,204)(H,201,255)(H,205,245)(H,206,258)(H,207,257)(H,208,260)(H,209,268)(H,210,264)(H,211,269)(H,212,281)(H,213,270)(H,214,280)(H,215,282)(H,216,285)(H,217,276)(H,218,259)(H,219,262)(H,220,272)(H,221,273)(H,222,263)(H,223,256)(H,224,265)(H,225,271)(H,226,274)(H,227,275)(H,228,261)(H,229,283)(H,230,277)(H,231,278)(H,232,284)(H,233,254)(H,234,266)(H,235,279)(H,236,267)(H,246,247)(H,248,249)(H,250,251)(H,252,253)(H,286,287)(H4,191,192,198)(H4,193,194,199)/t96-,103-,105-,106-,107-,108-,109-,110-,111-,112-,113-,114-,115-,116-,117-,118-,119-,120-,121-,122-,123-,124-,125-,126-,127-,128-,129-,130-,131-,132-,143-,144-,145-,146-/m0/s1
InChIKey
OGBMKVWORPGQRR-UMXFMPSGSA-N

Chemical identity describes the recorded molecular information. It does not establish biological activity, clinical efficacy, safety, or therapeutic suitability.

Explore further

Continue through the research system

Move from this peptide record into the project's broader evidence, research, comparison, and methodology systems.

Research discovery

Compare peptides

Examine represented peptide records side by side.

Evidence system

Explore how scientific evidence is represented and reviewed.

Research hub

Enter the broader research and intelligence environment.

Methodology

Review project methods, boundaries, and interpretation rules.

Research

How the scientific record is developing

Chronology, unresolved research questions, opportunities, and researcher activity remain descriptive rather than evaluative.

Research chronology

  1. 2003 · study · Temporal status not established

    Teriparatide (forteo) for osteoporsis.

    The Medical letter on drugs and therapeutics

  2. 2005 · study · Temporal status not established

    Teriparatide reduces the fracture risk associated with increasing number and severity of osteoporotic fractures.

    The Journal of clinical endocrinology and metabolism

  3. 2007 · study · Temporal status not established

    Teriparatide or alendronate in glucocorticoid-induced osteoporosis.

    The New England journal of medicine

  4. 2012 · study · Temporal status not established

    Teriparatide and the risk of nonvertebral fractures in women with postmenopausal osteoporosis.

    Bone

  5. 2013 · study · Temporal status not established

    Teriparatide and denosumab, alone or combined, in women with postmenopausal osteoporosis: the DATA study randomised trial.

    Lancet (London, England)

  6. 2014 · study · Temporal status not established

    Two years of Denosumab and teriparatide administration in postmenopausal women with osteoporosis (The DATA Extension Study): a randomized controlled trial.

    The Journal of clinical endocrinology and metabolism

  7. 2015 · study · Temporal status not established

    Efficacy of weekly teriparatide does not vary by baseline fracture probability calculated using FRAX.

    Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

  8. 2015 · study · Temporal status not established

    Denosumab and teriparatide transitions in postmenopausal osteoporosis (the DATA-Switch study): extension of a randomised controlled trial.

    Lancet (London, England)

  9. 2015 · study · Temporal status not established

    FRAX and the effect of teriparatide on vertebral and non-vertebral fracture.

    Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

  10. 2016 · study · Temporal status not established

    Relative bioavailability between two teriparatide formulations in healthy volunteers.

    International journal of clinical pharmacology and therapeutics

  11. 2016 · study · Temporal status not established

    Safety and effectiveness of daily teriparatide in a prospective observational study in patients with osteoporosis at high risk of fracture in Japan: final report.

    Clinical interventions in aging

  12. 2017 · study · Temporal status not established

    Relationship between bone turnover and density with teriparatide, denosumab or both in women in the DATA study.

    Bone

  13. 2018 · study · Temporal status not established

    Effects of teriparatide and risedronate on new fractures in post-menopausal women with severe osteoporosis (VERO): a multicentre, double-blind, double-dummy, randomised controlled trial.

    Lancet (London, England)

  14. 2019 · study · Temporal status not established

    Comparison of Teriparatide and Denosumab in Patients Switching From Long-Term Bisphosphonate Use.

    The Journal of clinical endocrinology and metabolism

  15. 2020 · study · Temporal status not established

    Standard Versus Cyclic Teriparatide and Denosumab Treatment for Osteoporosis: A Randomized Trial.

    Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research

  16. 2020 · study · Temporal status not established

    Teriparatide Promotes Bone Healing in Medication-Related Osteonecrosis of the Jaw: A Placebo-Controlled, Randomized Trial.

    Journal of clinical oncology : official journal of the American Society of Clinical Oncology

  17. 2020 · study · Temporal status not established

    Denosumab, raloxifene, romosozumab and teriparatide to prevent osteoporotic fragility fractures: a systematic review and economic evaluation.

    Health technology assessment (Winchester, England)

  18. 2022 · study · Temporal status not established

    Teriparatide and pelvic fracture healing: a phase 2 randomized controlled trial.

    Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

  19. 2022 · study · Temporal status not established

    Teriparatide treatment in severe osteoporosis - a controlled 10-year follow-up study.

    BMC musculoskeletal disorders

  20. 2022 · study · Temporal status not established

    Randomized controlled trial of daily teriparatide, weekly high-dose teriparatide, or bisphosphonate in patients with postmenopausal osteoporosis: The TERABIT study.

    Bone

  21. 2023 · study · Temporal status not established

    Biosimilarity Assessment of the Biosimilar Teriparatide Candidate and the Reference Drug in Healthy Subjects.

    Clinical pharmacology in drug development

  22. 2023 · study · Temporal status not established

    Sequential therapy with once-weekly teriparatide injection followed by alendronate versus monotherapy with alendronate alone in patients at high risk of osteoporotic fracture: final results of the Japanese Osteoporosis Intervention Trial-05.

    Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

  23. 2023 · study · Temporal status not established

    Effectiveness and Safety of Treatments to Prevent Fractures in People With Low Bone Mass or Primary Osteoporosis: A Living Systematic Review and Network Meta-analysis for the American College of Physicians.

    Annals of internal medicine

  24. 2024 · study · Temporal status not established

    Efficacy and safety of teriparatide vs. bisphosphonates and denosumab vs. bisphosphonates in osteoporosis not previously treated with bisphosphonates: a systematic review and meta-analysis of randomized controlled trials.

    Archives of osteoporosis

  25. 2025 · study · Temporal status not established

    PTH1 receptor agonists for fracture risk: a systematic review and network meta-analysis.

    Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

  26. 2026 · regulatory · Temporal status not established

    Regulatory review: approved

    United States (FDA — BONSITY)

  27. 2026 · regulatory · Temporal status not established

    Regulatory review: approved

    United States (FDA — FORTEO)

The represented chronology reflects records currently included in the governed dataset and does not claim to represent the entire scientific literature.

What still needs investigation

Claim traceability

No institutional claim record is currently represented for this peptide.

Evidence is missing or not represented as studied; this is not a conclusion that the intervention does not work.

Researchers represented in the evidence record12 bibliographic identities · open to inspect

These are bibliographic author identities derived from represented records. Name strings are not proof of unique real-world researcher identity, and publishing organizations are not treated as institutional affiliations.

Benjamin Z Leder

4 represented evidence records

Years represented: 2013, 2014, 2015, 2019

Publishing organizations appearing in records: Lancet (London, England), The Journal of clinical endocrinology and metabolism

Alexander V Uihlein

3 represented evidence records

Years represented: 2013, 2014, 2015

Publishing organizations appearing in records: Lancet (London, England), The Journal of clinical endocrinology and metabolism

Hang Lee

3 represented evidence records

Years represented: 2013, 2014, 2015

Publishing organizations appearing in records: Lancet (London, England), The Journal of clinical endocrinology and metabolism

Joy N Tsai

3 represented evidence records

Years represented: 2013, 2014, 2015

Publishing organizations appearing in records: Lancet (London, England), The Journal of clinical endocrinology and metabolism

Robert M Neer

3 represented evidence records

Years represented: 2013, 2014, 2015

Publishing organizations appearing in records: Lancet (London, England), The Journal of clinical endocrinology and metabolism

Sherri-Ann M Burnett-Bowie

3 represented evidence records

Years represented: 2013, 2014, 2015

Publishing organizations appearing in records: Lancet (London, England), The Journal of clinical endocrinology and metabolism

D McMahon

2 represented evidence records

Years represented: 2020, 2022

Publishing organizations appearing in records: Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

A Odén

2 represented evidence records

Years represented: 2015

Publishing organizations appearing in records: Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

Ai Mori

1 represented evidence record

Years represented: 2022

Publishing organizations appearing in records: Bone

Alicia Bagur

1 represented evidence record

Years represented: 2018

Publishing organizations appearing in records: Lancet (London, England)

Amy Kwon

1 represented evidence record

Years represented: 2023

Publishing organizations appearing in records: Annals of internal medicine

Andrew Rawdin

1 represented evidence record

Years represented: 2020

Publishing organizations appearing in records: Health technology assessment (Winchester, England)

Connections

Follow the scientific relationships

Connections appear only when they are represented by the project’s underlying records.

Open 12 represented connections ↓

institution

Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA

represented evidence source

institution

Lancet (London, England)

represented evidence source

institution

Bone

represented evidence source

institution

The Journal of clinical endocrinology and metabolism

represented evidence source

institution

Clinical pharmacology in drug development

represented evidence source

institution

Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research

represented evidence source

institution

The New England journal of medicine

represented evidence source

institution

Journal of clinical oncology : official journal of the American Society of Clinical Oncology

represented evidence source

institution

BMC musculoskeletal disorders

represented evidence source

institution

International journal of clinical pharmacology and therapeutics

represented evidence source

institution

The Medical letter on drugs and therapeutics

represented evidence source

institution

Annals of internal medicine

represented evidence source

Traceability

Follow the record back to its source

The experience makes incomplete links visible instead of presenting a false impression of perfect provenance.

Source publication state

A governed source may be verified and approved for publication while its claim-to-evidence link is still incomplete.

Reviewer provenance state

“Human scientist reviewed: no” means that specific source-path attribution is not recorded. It does not silently negate the separate publication-review state.

Domain conclusion → Evidence

Connected

Evidence → Source

Connected

Source → Original record

Connected

Traceability documents how the project connects statements to records. It does not establish that a source is scientifically valid or that a claim is clinically true.

Reconciled for 5 domain conclusions and 0 featured studies.

Detailed study-to-domain mappings and original-source paths appear in the Teriparatide evidence-governance section.

Inspect the ranked source records

Observational archive

What contributors reported

Observational archive data is intentionally separated from published scientific evidence.

Observational boundary

Insufficient eligible observations are available for display under the current filters.

Insufficient eligible observations are currently represented to display aggregated findings for this peptide.

Regulatory context

Published jurisdictional records

Regulatory status is jurisdiction-specific and time-dependent. It is presented as context, not as a recommendation for use or a substitute for scientific evidence evaluation.

Research + media

Media connected to this scientific record

Only media explicitly linked through the project’s relationship system appears here.

No scientifically connected media is currently represented for this peptide.

Sources + provenance

Read the scientific record with its boundaries intact

The public record organizes reviewed evidence; it does not establish scientific truth by itself.
Association, mechanism, observation and regulatory status must not be represented as proof of clinical efficacy or safety.
Observational reports describe contributor experiences and cannot establish causation, effectiveness, safety or clinical benefit.
Contradictory and qualifying evidence must remain visible rather than being silently discarded.
Absence of represented evidence is not evidence that research does not exist.
Research gaps identify unresolved questions; they are not negative conclusions.
Regulatory status is distinct from scientific evidence quality.
Media relationships provide context and explanation; they do not increase the strength of scientific evidence.
A section with no represented records is an incomplete project record, not a scientific conclusion.
Researcher and institutional relationships are shown only when supported by represented records and must not be interpreted as rankings or endorsements.

Generated: 11/8/2026, 5:28:53 PM

global evidence atlas

Teriparatide research, ranked and separated by purpose

This is a deduplicated literature screening registry—not a claim that every mention directly proves efficacy or safety. Machine proposals remain visibly separate from governed human appraisal.

711Discoverable source universe
500Ranked screening records
5Research domains
0Accountably approved conclusions

500 matching records · ranked 2026-09-18

Page 1 of 20

Count reconciliation: 711 discoverable source records match the peptide identity query; 500 are retained in this bounded, ranked screening view; 0 belong to the separate governed layer labeled “Accountably approved conclusions.” Domain totals overlap because one publication may inform several questions.

governance and regulatory context

Teriparatide: what this atlas does and does not establish

Last checked
2026-09-18
Accountable publication approval
Not yet approved by a named accountable reviewer. Machine screening only.

No new outcome conclusion is inferred from discovery metadata. Named accountable approval is required for governed scientific conclusions.

Regulatory status by jurisdiction

Absence of a record in this pass is not proof that no authorization exists. Status must remain jurisdiction-, product-, formulation-, and date-specific.

  • United States (FDA — BONSITY)approvedchecked 2026-09-10

    BONSITY teriparatide is FDA-approved as a prescription subcutaneous teriparatide product for its labeled osteoporosis indications and populations.

    FDA Drugs@FDA — BONSITY NDA 211939
  • United States (FDA — FORTEO)approvedchecked 2026-09-10

    FORTEO teriparatide is FDA-approved for labeled osteoporosis indications in specified patients at high fracture risk; the current product, strength, route, duration guidance, warnings, and patient-selection language control.

    FDA Drugs@FDA — FORTEO NDA 021318

5 FDA structured product label record(s) were identified for this compound name in openFDA. Label presence reflects an approved product exists under that name; it is not a claim about the specific formulation, dose, or use being discussed anywhere else on this page.

No machine-proposed evidence-strength grades exist yet for this compound; all screening records are unassigned pending further review.

Teriparatide evidence · ranking key

How evidence is ranked

A tier describes the evidentiary role and design strength of a source. It is not a popularity score, proof that every conclusion is correct, or a substitute for claim-level review.

A

Practice-defining evidence

Large, well-conducted randomized trials; prespecified major outcomes; rigorous systematic reviews or meta-analyses; and major regulatory assessments.

B

Strong supporting evidence

Smaller randomized trials, strong prospective cohorts, prespecified secondary analyses, and high-quality comparative-effectiveness studies.

C

Contextual evidence

Retrospective cohorts, claims-database studies, pharmacovigilance analyses, mechanistic human research, and well-documented case series.

D

Signal-generating evidence

Case reports, conference abstracts, preclinical research, hypothesis-generating analyses, and expert commentary.

Tier and confidence answer different questions

Tier classifies source design and evidentiary role. Confidence reflects risk of bias, sample size, comparator quality, outcome relevance, follow-up, missing data, directness, replication, reporting quality, and whether conclusions stay within the measured results.

Funding and conflicts are disclosed and considered, but sponsorship never automatically changes a tier. Corrections, retractions, and expressions of concern override the original rating.

Suggested citation

  • APA

    World Peptide Foundation. (n.d.). Teriparatide — Peptide Scientific Intelligence. World Peptide Foundation. (Updated September 20, 2026.) https://www.worldpeptidefoundation.org/directory/teriparatide

  • AMA / Vancouver

    World Peptide Foundation. Teriparatide — Peptide Scientific Intelligence. World Peptide Foundation website. Updated September 20, 2026. https://www.worldpeptidefoundation.org/directory/teriparatide