United States (FDA — BONSITY)
Regulator: BONSITY)
approved
As of: 9/10/2026 · Temporal status not established
Scientific intelligence record
Experience 2.0
Recombinant human parathyroid hormone fragment (PTH 1-34)
Teriparatide
Teriparatide is the recombinant 1–34 amino-acid fragment of human parathyroid hormone and retains the receptor-active N-terminal region of PTH. Intermittent subcutaneous exposure activates PTH1 receptors in bone and kidney; in bone it increases osteoblast activity and remodeling, producing an anabolic treatment effect when used according to an approved regimen. Its effects depend on exposure pattern: intermittent therapeutic administration is not equivalent to sustained endogenous parathyroid-hormone excess. Evidence and authorization are formulation-, indication-, population-, duration-, and sequence-specific.
Record status
Traceability partial
Last meaningful update: 9/10/2026
- Evidence searched through:
- Not recorded
- Assessment updated:
- 9/10/2026
- Last human review:
- No accountable human review represented
Governed reviewed evidence
25
Governed records, not an efficacy score or total literature count.
Evidence boundary
0 / 25
Claim-linked support versus recorded evidence.
Research gaps
Human experience · separate evidence stream
No community pattern is displayed yet
Eligible observations remain below the privacy and reliability threshold. WPF will not convert a handful of reports into a percentage, trend, or clinical claim.
Observation is valuable human context. It is not evidence of causation, efficacy, or safety.
Public display gate
n ≥ 20 eligible observations
Exact progress remains private before the threshold.
Intelligence snapshot
The state of the record
A compact view of what is represented, what remains unresolved, and how completely the record can be traced.
Governed reviewed evidence
25
Reviewed database records promoted through the governed publication workflow.
Contradictions
0
Conflicting evidence relationships that remain visible.
Research gaps
1
Questions the current record identifies as unresolved.
Connected media
0
Media records explicitly linked to this scientific record.
What we know
Evidence, claims, and boundaries
The project separates represented evidence from qualification, contradiction, uncertainty, and what the evidence does not establish.
No public institutional claim is represented yet
This does not mean the scientific literature contains no findings. It means no reviewed institutional claim has been represented here.
Scientific context
Chemistry and represented biological context
Existing reviewed chemistry is preserved as scientific context. Chemistry and mechanism information do not establish clinical efficacy or safety.
Open chemistry and biological context ↓Close chemistry and biological context ↑
Chemical identity
Molecular and structural record
- Molecular formula
- C181H291N55O51S2
- Molecular weight
- 4118
- Amino acid sequence
- SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
- SMILES
- CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CNC=N2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC5=CNC=N5)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC6=CC=CC=C6)C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CO)N
Explore further
Continue through the research system
Move from this peptide record into the project's broader evidence, research, comparison, and methodology systems.
Research discovery
Research
How the scientific record is developing
Chronology, unresolved research questions, opportunities, and researcher activity remain descriptive rather than evaluative.
Research chronology
2003 · study · Temporal status not established
Teriparatide (forteo) for osteoporsis.
The Medical letter on drugs and therapeutics
2005 · study · Temporal status not established
Teriparatide reduces the fracture risk associated with increasing number and severity of osteoporotic fractures.
The Journal of clinical endocrinology and metabolism
2007 · study · Temporal status not established
Teriparatide or alendronate in glucocorticoid-induced osteoporosis.
The New England journal of medicine
2012 · study · Temporal status not established
Teriparatide and the risk of nonvertebral fractures in women with postmenopausal osteoporosis.
Bone
Connections
Follow the scientific relationships
Connections appear only when they are represented by the project’s underlying records.
Open 12 represented connections ↓Close represented connections ↑
institution
Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA
institution
Lancet (London, England)
institution
Bone
Traceability
Follow the record back to its source
The experience makes incomplete links visible instead of presenting a false impression of perfect provenance.
Source publication state
A governed source may be verified and approved for publication while its claim-to-evidence link is still incomplete.
Reviewer provenance state
“Human scientist reviewed: no” means that specific source-path attribution is not recorded. It does not silently negate the separate publication-review state.
Claim → Evidence
Incomplete
Evidence → Source
Connected
Source → Original record
Connected
Traceability documents how the project connects statements to records. It does not establish that a source is scientifically valid or that a claim is clinically true.
Incomplete links: claim-to-evidence
Inspect 25 source paths ↓Close source paths ↑
Efficacy of weekly teriparatide does not vary by baseline fracture probability calculated using FRAX.
Observational archive
What contributors reported
Observational archive data is intentionally separated from published scientific evidence.
Observational boundary
Insufficient eligible observations are available for display under the current filters.
Insufficient eligible observations are currently represented to display aggregated findings for this peptide.
Regulatory context
Reviewed jurisdictional records
Regulatory status is jurisdiction-specific and time-dependent. It is presented as context, not as a recommendation for use or a substitute for scientific evidence evaluation.
United States (FDA — FORTEO)
Regulator: FORTEO)
approved
As of: 9/10/2026 · Temporal status not established
Research + media
Media connected to this scientific record
Only media explicitly linked through the project’s relationship system appears here.
No scientifically connected media is currently represented for this peptide.
Sources + provenance
Read the scientific record with its boundaries intact
The public record organizes reviewed evidence; it does not establish scientific truth by itself.
Association, mechanism, observation and regulatory status must not be represented as proof of clinical efficacy or safety.
Observational reports describe contributor experiences and cannot establish causation, effectiveness, safety or clinical benefit.
Contradictory and qualifying evidence must remain visible rather than being silently discarded.
Absence of represented evidence is not evidence that research does not exist.
Research gaps identify unresolved questions; they are not negative conclusions.
Regulatory status is distinct from scientific evidence quality.
Media relationships provide context and explanation; they do not increase the strength of scientific evidence.
A section with no represented records is an incomplete project record, not a scientific conclusion.